PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000199965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 148aa    MW: 17685.4 Da    PI: 10.6215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000199965genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-141257448
                     S-HHHHHHHHHHHHH.TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkq.lGggtWktIartmgkgRtlkqcksrwqkyl 48
                     WT+eEde+l+d++ + +G g+W++I++  g++R++k+c++rw+++l
    MDP0000199965 12 WTKEEDEILLDYIIRvHGRGHWNRIPKVTGLRRSGKSCRLRWLNHL 57
                     ***********986527777************************97 PP

2Myb_DNA-binding60.24.5e-1963108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
    MDP0000199965  63 RGDFSEEEEDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNYWNNHL 108
                      899*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.119157IPR017930Myb domain
SuperFamilySSF466893.39E-287104IPR009057Homeodomain-like
SMARTSM007173.8E-10859IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-211164IPR009057Homeodomain-like
PfamPF002493.9E-121157IPR001005SANT/Myb domain
CDDcd001672.58E-91257No hitNo description
PROSITE profilePS5129426.57258112IPR017930Myb domain
SMARTSM007173.6E-1762110IPR001005SANT/Myb domain
PfamPF002493.9E-1863108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2665112IPR009057Homeodomain-like
CDDcd001671.06E-1166108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MEGEYEYKKR LWTKEEDEIL LDYIIRVHGR GHWNRIPKVT GLRRSGKSCR LRWLNHLSPN  60
VKRGDFSEEE EDLIIRLHNL LGNRWSLIAG RVPGRTDNQV KNYWNNHLYK KLNAIKKRQT  120
PRKAAVVSAK FKICQQSVFP EEKICRQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-251211410110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351055.11e-107PREDICTED: transcription factor WER-like
SwissprotQ9SEI03e-61WER_ARATH; Transcription factor WER
TrEMBLM5XZK09e-66M5XZK0_PRUPE; Uncharacterized protein
STRINGVIT_01s0127g00730.t013e-60(Vitis vinifera)
STRINGVIT_17s0000g08480.t012e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-62myb domain protein 66